McDonnell Genome Institute

Washington University

CircRNA

chr22|17896723|17896981|-|MICAL3|ENST00000383094.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9865

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

RLGAGAER

Amino Acids from 5' Exons

DYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINHYGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLE,TTPTQSSCFPEKTWTRRLCSAMPGRRQTSLPSSSCRLWILPSITMGSPMWPCLTSLVCMPPRTPPWCGSRTDTSYWLWSGTAS,LRRHRAPAFPRKRGPGGSAQLCQGGGRLLYPAAAAVSGFCHQSLWAARCGHVLHLYVCLRERRLGAGAERTPVTSGSGRGQPPR

Amino Acids from 3' Exons

DYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINHYGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLE,TTPTQSSCFPEKTWTRRLCSAMPGRRQTSLPSSSCRLWILPSITMGSPMWPCLTSLVCMPPRTPPWCGSRTDTSYWLWSGTAS,LRRHRAPAFPRKRGPGGSAQLCQGGGRLLYPAAAAVSGFCHQSLWAARCGHVLHLYVCLRERRLGAGAERTPVTSGSGRGQPPR