top of page

McDonnell Genome Institute

Washington University

CircRNA

chr21|46356973|46363934|+|PCNT|ENST00000359568.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.937

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

ASLGASPGCAGR

Amino Acids from 5' Exons

SFPGCISRVCRTGTWRPTQSGQPESWVWKLSTRCNFRFFRLSSKKKLNSKKIEICMGSCSMKLVRTIWR,ASLGASPGCAGRGLGGRHRAGSQSLGSGNAQGATFASSDAQRRNTPKNRKKFVWEVAANSSEGRFGE,LPWVHLQGVQDGDLEADTERAARVLGLETEHKVQLSLLQTELKEEIELLKIENRNLYGKLQHETRLKDDLEK

Amino Acids from 3' Exons

VKHNLIEDHQKELNNAKQKTELMKQEFQRKETDWKVMKEELQREAEEKLTLMLLELREKAESEKQTIINKFELREAEMRQLQDQQAAQILDLERSLTEQQGRLQQLEQDLTSDDALHCSQCGREPPTAQDGELAALHVKEDCALQLMLARS,NTILKTTRRNIMLSKRLSNRNSKEKKRTGKLRRSYSGKLRRSHCYLNEKRLNPRNRPSTSLSFEKLKGSFRTNRQPRSWIWRGPRSSRAACSSWNRTSLQTTPCIAASVGGSRPQPRTGSLLRSTRKTAPCSCWPGA,KTQSNRPPEGTKCAKDADETGIPKKRNGLESYEGGATAGSGEVNIDATTERKGIRETDHHKQVASRSNEAASGPTGSPDPGSGEVLDGAAGPPAAAGTGPHFRRRPALQPVWAGAAHSPGRGACCAPREGRLRPAADAGPEQ

bottom of page