McDonnell Genome Institute

Washington University

CircRNA

chr21|45982633|46001386|+|COL6A1|ENST00000361866.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9948

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

14

Peptide

RQGHRPAEPGRAGQDCPVDLFFVLDTSESVALR

Amino Acids from 5' Exons

TAPWTCSLCWTPLRAWPGSPTGPSWTKSSPSPSASSTTGT,LPRGPVLCAGHLERGPEAEALRGPRGQSQVLHQALHRQPEGQ,CPVDLFFVLDTSESVALRLKPYGALVDKVKSFTKRFIDNLRD

Amino Acids from 3' Exons

NASAAPSTSCSCWTAQRALACRTSRLPRTSSSRSSTGAGTSWS,MQVRPHRPPVRAGQLREHWPAELRDCQGLRRQGHRPAEPGRAGQ,CKCGPIDLLFVLDSSESIGLQNFEIAKDFVVKVIDRLSRDELVK