McDonnell Genome Institute

Washington University

CircRNA

chr21|45468241|45468786|+|COL18A1|ENST00000355480.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9557

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

MTPTSGWPTSLGQMPTVAK

Amino Acids from 5' Exons

SASARRWGCCSSLGTPRPSRSPRRMTPTSGWPTSLGQMPTVAKWPGTTSPASSSVTSHCCSTSGQPQRAQGCCSPSRTRRRPWSCWASSLGCRTGTRTSPCSTQNQVQARPTQPPASGSPPSSASGHTPSVWQVALWPSTWTVRSSRECRLLGPHGAWSWSLAPGSSWLRRGERTLTSS,AHQRGGGAAAAPWGPPAPAGHPDGPRRRAGLRLWARCQQWPSGPVPLPQPLLPLLTAVPHPASHRGPRGAVRHHGLGAGHGLAGREALWGAGRAPGHLPALHRTRCRPDPHSRQLPAPRLRRPVDTLSPQCGRWLCGPLRGLGVPENAACSVLTGPGAGAWRRALRGSGGGSGPQVP,RISEEVGLLQLLGDPPPQQVTQTDDPDVGLAYVFGPDANSGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAMVLLGVKLSGVQDGHQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDCEEFQRMPLARSSRGLELEPGAGLFVAQAGGADPDKFQ

Amino Acids from 3' Exons

SASARRWGCCSSLGTPRPSRSPRRMTPTSGWPTSLGQMPTVAKWPGTTSPASSSVTSHCCSTSGQPQRAQGCCSPSRTRRRPWSCWASSLGCRTGTRTSPCSTQNQVQARPTQPPASGSPPSSASGHTPSVWQVALWPSTWTVRSSRECRLLGPHGAWSWSLAPGSSWLRRGERTLTSS,AHQRGGGAAAAPWGPPAPAGHPDGPRRRAGLRLWARCQQWPSGPVPLPQPLLPLLTAVPHPASHRGPRGAVRHHGLGAGHGLAGREALWGAGRAPGHLPALHRTRCRPDPHSRQLPAPRLRRPVDTLSPQCGRWLCGPLRGLGVPENAACSVLTGPGAGAWRRALRGSGGGSGPQVP,RISEEVGLLQLLGDPPPQQVTQTDDPDVGLAYVFGPDANSGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAMVLLGVKLSGVQDGHQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDCEEFQRMPLARSSRGLELEPGAGLFVAQAGGADPDKFQ