McDonnell Genome Institute

Washington University

CircRNA

chr21|44893403|44895060|-|ITGB2|ENST00000302347.9

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

44

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

18

Peptide

SAVGELSEDSSNVVHLIK

Amino Acids from 5' Exons

KLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVP,NSPPGSSWITTPSPTPKSPTTPSAAMERTGTSPEVTVMACRSMS,TLLQGLPGSQRPPRHPESHLRLLLQQWSDAQEPAQRLWRADQCP

Amino Acids from 3' Exons

KLTEIIPKSAVGELSEDSSNVVHLIKNAYN,NSPRSSPSQPWGSCLRTPAMWSISLRMLT,THRDHPQVSRGGAVGLQQCGPSHECLQ