McDonnell Genome Institute

Washington University

CircRNA

chr21|44052279|44063785|+|TRAPPC10|ENST00000291574.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

16

Peptide

ALELLHNCVQELKLLEDTEVYK

Amino Acids from 5' Exons

DTEVYKATVKDDLTKWQNVLKAHSSVDWLIVIVENDAKKKNKTNILPRTSIVDKIRNDFCNKQSD,IPKCIKLQKMTSPSGRMFRLIALWTGLKMMPRKKTKPTSFPEPLLWTKEMIFVINRVT,YRSVSYSKRPHQVAECSEGSLCGLVNSDSKCQEKKQNQHPSPNLYCGQNKKFLTEQ

Amino Acids from 3' Exons

MVPTGLFSASQRAGTDSSENPIWRSGNRSRGEKPPCICAVTCSLASAPCCSSCRGRGRWPSAPSCCTTACRNSS,WCQLADFFLPASEELERIDPPKTHRYGEAGIDPEARSHPVRSAQLPVLSPVHLAALPAEAVGGGPARPRAAAQLRAGTEALR,GANWLTFFCQPVKSWNGLILRKPIDMEKRESIQRREATLLDLRSYLFSRQCTLLLFLQRPWEVAQRALELLHNCVQELKLLE