McDonnell Genome Institute

Washington University

CircRNA

chr21|42896926|42904276|+|NDUFV3|ENST00000354250.6

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

VASPSPSGSVLFTDEGVPK

Amino Acids from 5' Exons

TMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPK,LCSRKPRCFEDLLLRFLCLRNQGRVKRVSHRIPRSKVHQK,YAPGSPGVSRTCFYGFFVCGIREEKGSATEFQEAKSTK

Amino Acids from 3' Exons

MWNQRRGASSPPRQQLNCLKTYLHPVLTRQLIRAGRLVPVPVAACYSQMKGFRNFCQERLWSFHRKFCLHSENRALIQKLVRWVGKRRLRLHPLPAPLILNLMMRLTFQRSLLEWAKAEGGFENQRPLIPLKTEPPELQYQQKRKPCCRSRMWTLLIQRSPTSQRRKGPLLSHQKAGKMRDQKPQCPDLKMKSFSKVRKNNCRKHLDMKIKKAKSHLKLKDPYLSTQNQGCLRHRRAAQRLLCWQKRPEQRGSCKPVLLGRQRGIWKNPCQSPSARRPLPCPERKPQGRREKATRVDRQSWKIRYHQAIWRQFLLRITTVSMKRQQRSLRPRARPWKMQPRQGTTEAAHR,CSGTKGEGQAPSHPDSSIVKLIFTQFLPASCEGQEGSSQSQWQRAIHRRGSEIFVKKDFGRVSTESSVSIQKTGLFRSSSGGSESDVAFVFILFQLLFIGRFRGHSSSGEQRQRGASKTRGLSFLKQSPPSYSISKRENLAAEAACGHYSREAPPAKEERVPCAIRRQGKCETKNHNAQISSRRVFEAKFKGKTIAENIIKNRRKPKAISRTLTCPHKIRVVCATEGQPSACCVGRRGQSRGAAASQSSWGGRGASGKTRARAPAQGGPSPAQKGNLRDAGNRRPPEGWTGNRGRSDTTKQFGDSSCEPRFPKDSSAEAGRGRGHGRCSRARGRPRRHT,VVEPKERGKLLATQTAAELSKNLSSPSSYPPAVNKGRKVASPSPSGSVLFTDEGVPKFLSRKTLVEFPQKVLSPFRKQGSDSEARQVGRKVTSPSSSSSSSSSDSESDDEADVSEVTPRVVSKGRGGLRKPEASHSFENRAPRVTVSAKEKTLLQKPHVDITDPEKPHQPKKKGSPAKPSEGRENARPKTTMPRSQVDEEFLKQSLKEKQLQKTFRLNEIDKESQKPFEVKGPLPVHTKSGLSAPPKGSPAPAVLAEEARAEGQLQASPPGAAEGHLEKPVPEPQRKAAPPLPRKETSGTQGIEGHLKGGQAIVEDQIPPSNLETVPVENNHGFHEKTAALKLEAEGEAMEDAAAPGDDRGGTQ