McDonnell Genome Institute

Washington University

CircRNA

chr21|41743881|41751245|-|RIPK4|ENST00000332512.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9823

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

EPSTSDF

Amino Acids from 5' Exons

VVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLSGVSSVDSAFSSRGSLSLSFEREPSTS,WCLRGSSGPLPPPSITTTASPSCSHSWTLEFPRLSRAPRSSAAAPLSPSCHRPAVGRGSRGCPRWTPPSLPEDHCRCPLSGNLQPA,GACEAQAGLCPHLRRLQPLRAALTAGLWSFPGCRGPRGAQPQLLVQAAIVRQWEEALGGVLGGLRLLFQRITVAVLAGTFNQ

Amino Acids from 3' Exons

ISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVY,FLILVWPSATGCPTRMTSAWMACLAQSPTSLQSASGRRAGSSTPSTMYT,FFWSGQVQRAVPLAPQHGWPVWHNRLPPSRAHQGEEPALRHQARCIQ