McDonnell Genome Institute

Washington University

CircRNA

chr21|41471805|41498189|-|TMPRSS2|ENST00000332149.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9617

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

YLSLLDAVDNSK

Amino Acids from 5' Exons

TSQSMALDGICGDFETIFHVLWSRIPSRKSDFSSKLLQDQEQHCADEAAEASDFQ,PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFN,LLTIHGIGRHLRGFDNLSCSMEPDTKKKFLIQIMTPRPRTMTLRSCRSLLST

Amino Acids from 3' Exons

VILNIPDTYHYSMLLITARWLT,SYTFQIPIITRCCQQDGFEL,HIEHSRYLSLLDAVDNSKMALNS