McDonnell Genome Institute

Washington University

CircRNA

chr21|41432049|41449295|+|MX1|ENST00000398598.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.957

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

KEDGCFR

Amino Acids from 5' Exons

LTLQRRKMVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGS,LLCKEGRWLFPKWTSQKLIQLLHPTLYYMEMLLWPRKIQA,YFAKKEDGCFRSGHRKSSSCCIPPSITEWRCYCGPEKSRL

Amino Acids from 3' Exons

AIKFVEKSRNLKISIVVESCQALITGHLRQSNSKSRHWKSRLWICYTPR,PNFEKNPEIKSVSWRAARLCELQDIDNRETANQGTGRAGCGYATHRD,HKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVT