McDonnell Genome Institute

Washington University

CircRNA

chr21|39295742|39298582|-|BRWD1|ENST00000333229.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9306

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

IFTVLSNK

Amino Acids from 5' Exons

WRYIEENNSQGVPLLVQHFQELCISIKCTEGFSDIYLLFTVHLIGQDIESL,GDTSRKTTHRVFHFYSISRNYVSAYKNAQKDSRTSICCLLCSIDRTNLY,EIHRGKQLTGCSTFSTAFPGTMYQHIKMHRRILGHLSAVYCVAFDRTGHRIFT

Amino Acids from 3' Exons

VLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAK,SCPISMWLLIIFCKSASASVLCWIKKFHPVFQESLLYLVQEGSLCYVQQK,LVQACGSSSFANLPAHRSYVGRNSTQYFKSHFFTWCRKAVFATYSK