McDonnell Genome Institute

Washington University

CircRNA

chr21|39255664|39274472|-|BRWD1|ENST00000412604.1

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9209

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LLQNVTCR

Amino Acids from 5' Exons

VLEGATFSPLQILVCVVVDKLKVFVRCIKTLHAVRLLQNVTCRLGNEEWLYQ,FKAELRHSVPSKYWSASWTSRCSSDASKRSTQSDCYRTPAGLETKSGCTR,FRRLSLDIQSPPNIGLRRSGQVEGVRQMHQNAPRSQIATERDLQAWKRRVVVPE

Amino Acids from 3' Exons

VPKWQRWNSTDLEIAVRMEEHFIGYGYQNLR,FLSGSRDGTARIWRFEQLEWRSILLDMATRIS,SVVAEMEQHGFGDLSSNGGAFYWIWLPESQ