McDonnell Genome Institute

Washington University

CircRNA

chr21|36896859|36962170|-|HLCS|ENST00000336648.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.956

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

LLDGPLK

Amino Acids from 5' Exons

EIRDPLMQWLGKHVDSEGEIKSGQLSLRFVSSYVSEVEITPSCIPVVTNMEAFSSEHFNLEIYRQNLQTKQLGKVILFAEVTPTTMRLLD,KSGILLCSGLGNMWTPREKNPASSLLDLFHPTCLKKPHLVYLWPTWRPSHQNISTRSIAKICRPSSWGKFCLPKPPQRCVSWM,NQGSSYAVAWETCGLRGRNKIRPALSICFILRVSRNNPILYTCGDQHGGLLIRTFQLRDLSPKSADQAVGESNFVCRSDPHNDASPGW

Amino Acids from 3' Exons

SIEDLNKWALFLVSPFILEAEHIAFVTESIWVQSENLQRSSSSET,PLKTTSGPYFLCLLLYLKQNTHLRRAFGYKVRIYRDHPLQK,HRLEQVGPISCVSFYTSRTHSICDGEHLGTKEFTEIILFRN