McDonnell Genome Institute

Washington University

CircRNA

chr21|33522187|33525000|-|GART|ENST00000381815.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9898

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

19

Peptide

ATSRSGFPEAQALGLEVFHAGTALK

Amino Acids from 5' Exons

EFDLQGIWSRYRSWKYAGQENSAFSKSHFQI,SLTYKESGVDIAAGNMLVKKIQPLAKATSRS,VLTRNLEISQLEICWSRKFSLQKPLPDQ

Amino Acids from 3' Exons

GFLRLKLDWRCSMQALPSKMAKLMGVEFLQSQPSGKISYQPLRKPRKDLLSLREQFIGKTSAFVPLSSSSP,VSGSSSRTGGVPCRHCPQKWQSSNSWGSSCSHSHPGKSHISPGSQERTSCYKVGSNLERRRLSCHSFPPAAQ,FPEAQALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKDVGFRAIAFLQQP