McDonnell Genome Institute

Washington University

CircRNA

chr21|32673339|32688367|-|SYNJ1|ENST00000357345.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9739

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

9

Peptide

LAGIQEFQGGISSCPYVK

Amino Acids from 5' Exons

HLLKYRACVRISTNIQSLRKFEYVSEPGMMVGSNFAALLRIRHSLTGFLMHPSLASRSFK,IFSTKEHVEFLQIFKAENSSMCRNLECEWWEAISQHSFESDTHLASCTQVSWHPGVS,SSKVLKSMCENFYKYSKPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTDWLLDAPKLAGIQEFQ

Amino Acids from 3' Exons

VGSHRVRMSRGFEANAPAFD,WDLIVSVCQGDLKPMHLLLT,GISSCPYVKGISQCTCFQ