McDonnell Genome Institute

Washington University

CircRNA

chr21|31924467|31990176|+|HUNK|ENST00000270112.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9133

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

8

Peptide

DLEFHAVQVAIK

Amino Acids from 5' Exons

VAIKVIDKKRAKKDTYVTKNLRREGQIQQMIRHPNITQLLDILETENSYYLVMELCPGGNLMHKIYEKKRLEESEARRYIRQLISAVEHLHRAGVVH,WPKSLIRREPKRTPMSPKTCGERVRSSRSATPISLSSLIFKRKTATTWSWSCALGATCTRSMRRSGWRSPKPADTSDSSSLPSTCTGPGWST,GHKSHEESQKGHLCHQKPAARGSDPADDPPPQYHSAPYFRNGKQLLPGHGAVPWGQPDAQDLEEAAGGVRSPQIHPTAHLCRRAPAPGRGGPQ

Amino Acids from 3' Exons

ASLDTWTRDLEFHAVQ,PLWTPGHEILNSMPC,LSGHLDTRSIPCRA