McDonnell Genome Institute

Washington University

CircRNA

chr21|26050999|26053348|-|APP|ENST00000346798.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9954

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

KVTMWILLMR

Amino Acids from 5' Exons

TCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADG,HAVRRVPTCMTTACCCPAELTSSEGSLCVAHWLKKVTMWILLMRRRMTRMSGGAEQTQTMQMG,MQEEYQLALRHVAALRNQVPRGRVCVLPTGRKQCGFCCGGGLGCLVGRSRHRLCRWE

Amino Acids from 3' Exons

LVSLVMPFSFLTSANSYTRRGWMFAKLIFTGTPSPK,WVCKCPSRSQVQILTPGEDGCLRNSSSLAHRRQR,GEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKE