McDonnell Genome Institute

Washington University

CircRNA

chr21|21373862|21374013|+|NCAM2|ENST00000284894.8

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9978

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LQAELEGIKR

Amino Acids from 5' Exons

SLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIE,AWTAVSKSKGSMEAHHCILKMSCQIQGDMTVKLQAELEGIKRACTLILN,PGRPYRSQRAAWKLITAYRCEVVRFREILSCKQNWRASKEHVPY

Amino Acids from 3' Exons

SLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIE,AWTAVSKSKGSMEAHHCILKMSCQIQGDMTVKLQAELEGIKRACTLILN,PGRPYRSQRAAWKLITAYRCEVVRFREILSCKQNWRASKEHVPY