McDonnell Genome Institute

Washington University

CircRNA

chr21|15791501|15818846|+|USP25|ENST00000285679.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9385

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

IQENQAK

Amino Acids from 5' Exons

SSSQHSRESMFEEDTYRSLEGFSKPLKKTGQSSRWAKECWQYLLVCCYS,VLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWFSAVIQ,FLKPAQRIKHVRGHLQKFGGILETLMIEKDRTKLPLGRMLAILVGLVLLF

Amino Acids from 3' Exons

VKNLKTLKCLVSTHFRSMGSKICMSAKLQLKEKLSLYIQRIQENQAK,KIKHNVWSVPTSGQWVQRSAVPRSCNDRRNVFTFREFRKIRPR,KKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQE