McDonnell Genome Institute

Washington University

CircRNA

chr21|15777903|15833548|+|USP25|ENST00000285679.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9203

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

8

Peptide

ESETSVTTDVIDLTGDDK

Amino Acids from 5' Exons

MLISLEMIKMIFREQLPVWPNQTGHSGRLELMRNKPLA,CDSHWRRSSESNCLEFGRIKQGIQGDWNNGTSHQ,VIDLTGDDKDDLQRAIALSLAESNRAFRETGITDEEQAIS

Amino Acids from 3' Exons

RSLIKKLGSPLLVKHYHRIEILLRKTTNDLKKNKNGMHNLPRKLCRKSFRLRNESQRLLQQ,GVRNWAAPCWYRNITTGFERFCGRQPTIKRTRRMGCTTCPESFAGKAFSVSEIERVRDFCDN,EFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQKLRESETSVTT