McDonnell Genome Institute

Washington University

CircRNA

chr21|10454133|10473729|+|BAGE2|ENST00000470054.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

23

Peptide

EDSELSTGLMDSEMTPTIEGCVK

Amino Acids from 5' Exons

RCAFCKHFGATIKCCEEKCTQMYHYPCAAGADTFQDFSHIFLLCPEHIDQAPER,DVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTPFRISVTSSCFVQNTLTKLLKD,MCILALWSHYQMLREMYPDVSLSLCCRSRHLSGFQSHLPALSRTHPSSK

Amino Acids from 3' Exons

IPNWKNRFLMRLIVKKKCLLKSIFVAKIKLKIKWKQKTLKSLHTRSLCSKSNCSCRNLKQWYPKKNQGLQNLSLNLSLFHKPCPHMRKALHYVLRNSWLKGYKEKRNRKKILNFLLDWTLKLLQLRVVKMFHTKEANLSYHLRQSHHFHYQQTARQMCLPPQHLLQTCLRMTCCVITLQLLVPLLETSCQQLTSQSLQKTGMGKPAITKRKFSPGRPRSKQ,EYRIGKTDFGRNENVFSEAYLWRRSNRNGSDRKHSRYTPDHCAARATAVVRGTNSGIQRRIKASKICHICHSSTRNLSVPTGKHFIMSGTVGYRKATRRKGTERRFTFYWIDGLNDSYNGLCERCFIPRRQIYKVIIDRVIIFIISRHKQGRCVFLPNTFFRLAFAHAALPFSSFLCWKHHANNLHLSHSKKLAWVNQLLLRENFLLVDLGPN,NTELEKQISNEADSEEMKMSSEVKHICGEDQIEDKMEVTENIEVVTHQITVQQEQLQLLEEPKTVVSKEESRPPKFVIESVTLPLETLVSPHEESTSLCPEEQLVIERLQGEKEQKEDSELSTGLMDSEMTPTIEGCVKDVSYQGGKSIKLSSETESSFSLSADISKADVSSSPTPSSDLPSHDMLRNYPSALSSSAGNIMPTTYISVTPKNWHGTSYYEKIFSWTSVQT