McDonnell Genome Institute

Washington University

CircRNA

chr20|8657183|8774719|+|PLCB1|ENST00000338037.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.938

90

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LNDSIPQEDFTPEVYR

Amino Acids from 5' Exons

NDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSE,MIQYLKKISLQKCTEFSSTTFALDLKLITSFQN,FNTSRRFHSRSVQSFPQQPLPSTNHLFRI

Amino Acids from 3' Exons

IGTQQPSWFINDARPRCSGCNDPKVNRLEGQTTAAAASSARTVLKIPEARTYT,SEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKL,RNPAALIMVHQRLSKTSLLWMLKPKSTRTNNSSSCLIFGKNSIIVKNTRSENILN