McDonnell Genome Institute

Washington University

CircRNA

chr20|8628293|8685078|+|PLCB1|ENST00000338037.10

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9187

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

TTPTSQDPK

Amino Acids from 5' Exons

DPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLVAFQEEVAK,TPNYVNFWMWGTSGAWSSASQWCMGLTSTSPIISWLSKKKWP,PQITTFGCGEHRAPGAAHDHSGVWAPREHLPFESRGFPRRSGQ

Amino Acids from 3' Exons

DKYQWMGSCAIVEKKTESFHLRNWIMKTCLSPFLTISLIPRTTPTSQ,TNISGWVHALSEWRRKRSRFTETGFERHVSAPFSLFHFLAQHLPH,QISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLT