McDonnell Genome Institute

Washington University

CircRNA

chr20|63966140|63967952|-|ZNF512B|ENST00000369888.5

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9511

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

RDDGSFLR

Amino Acids from 5' Exons

GAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPISRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVTKAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVTKPVPVTKPVTVSRPIVVSKPVTVSRPIAISRHTPPCKMVLLTRSENKAPRATGRNSGKK,VPSQIAWPSPAPSARPHSPLRPSWRNTGSGTTWTDPCLPPSLGPSAGRSPSAGLLGSASPSEANLSLLANLWVSANPLASASQSRSADPCQSPRPSRSLGPCQSPNLSQSAGPCPSPRPCRSPNPSQSPSLCRSPNPYLSPNPLRQSLQLRNPCRSPSQQSAGPLWSASRQSAGPLLSADTHRPAKWCCPGRRTKHLVPQGGTVVRK,CHLRSPGLPLPLLRGRIHLDPAGETPDLEPHGPTPACLQAWAHQQAGHHQPACWGQQAHRSEQTCHYWQTCGCQQTHWHQQASLGRQTHASHQGHPGHARASHQTCHSQQAHARHQGHAGHQTHHSHQVCAGHQTRTCHQTHYGNKACDSYETRAGHQASDSQQAHCGQQAGDSQQAHCYQQTHTALQNGAADQVGEQSTSCHREEQWEK

Amino Acids from 3' Exons

RRILSALEAVGSRGPARVVPGRMAAERRSDFQCCMTHRRW,DDGSFLRWRPSAPGVQQEWSREGWQPKGGPTSNAAPTED,MTDPFCVGGRRLPGSSKSGPGKDGSRKEVRLPMLHDPPKM