McDonnell Genome Institute

Washington University

CircRNA

chr20|63734704|63738499|+|RP4-583P15.15|ENST00000490623.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

VCPRPEAQR

Amino Acids from 5' Exons

WWGQMLWTLGPAALPLLAGRCTREVAPDSSPRWAMSLAR,GGVRCCGLWDLQLCLCWLGGAHARYRLQTPHQDGLVWQ,VGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGK

Amino Acids from 3' Exons

PCGLPAWISCAHTGWRCPGTSPDRRQPPLPSHTRSCPGLCRQLQPPQGALASRPPIPTWGWRPFPGSAWRPALWWPSMPASRSAKGPIAVPKSHSRGRLRPRPL,PAACQHGSPAPTLAGGVQGHHRTAGSPLCLPTPGAAPGSAGSCSHRRVRWPRGHLFQRGAGGPSRGQPGGQPCGGRVCPRPEAQRDPSQSPRATAGEDGDPGRS,LRPASMDLLRPHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAGLEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQ