McDonnell Genome Institute

Washington University

CircRNA

chr20|63595609|63597860|-|GMEB2|ENST00000266068.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9957

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

EVHPEGLEESHPHER

Amino Acids from 5' Exons

EDHGLRGTGLLPAQGLLQHLPQHKDPLRSPCVPEQPHVGRVHSPHARRSR,KIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPLTPAAAD,RSWTPGNWTSTSMTRSAPTPAAAQRLTSQEPVCPAAPRRPSTFPSRPPQPT

Amino Acids from 3' Exons

YDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIML,TTSMSAQRNLCTWPGSPPRTGREPSATASCS,RRACNQPKGICAPGREVHPEGLEESHPHERHHAQ