McDonnell Genome Institute

Washington University

CircRNA

chr20|63561822|63561984|-|HELZ2|ENST00000427522.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9271

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

SVDVLAGTGK

Amino Acids from 5' Exons

VQGRRSWASTSYSGFINQTRSRCSPEAPPVGRSGWGVPASCTAAPPTSRWMSWQ,YREDDRGPPHRILVSIKPGAGAARRPPPWGEAAGGSLHLVLRPLQQVGGCPG,TGKTIVGLHIVFWFHKSNQEQVQPGGPPRGEKRLGGPCILYCGPSNKSVDVLA

Amino Acids from 3' Exons

VQGRRSWASTSYSGFINQTRSRCSPEAPPVGRSGWGVPASCTAAPPTSRWMSWQ,YREDDRGPPHRILVSIKPGAGAARRPPPWGEAAGGSLHLVLRPLQQVGGCPG,TGKTIVGLHIVFWFHKSNQEQVQPGGPPRGEKRLGGPCILYCGPSNKSVDVLA