McDonnell Genome Institute

Washington University

CircRNA

chr20|62303567|62304577|+|ADRM1|ENST00000253003.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9761

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

6

Peptide

LFFWMQDDDLRR

Amino Acids from 5' Exons

DDDLRRALSKPGARLSGRLQQVLGGVSGGKDVPEGDHRDSGAERAGVHSADGRLAYSLLLEGQDVRERGR,MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVED,RPQARSFQAWCQALGAPPTSTWWSFGRERCPRGPPLRISGKGWCTFSRRTTRLFTSAGRTGRPGTWK

Amino Acids from 3' Exons

DLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQ,TSSSLTTVSSSGCRSAPAGGSTCSSRQGPSGFSSGC,LDHLPRLVQAGAAVPQREGLRAEVQGRVQAAFLLDA