McDonnell Genome Institute

Washington University

CircRNA

chr20|6084039|6085287|-|FERMT1|ENST00000217289.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

2

Peptide

FIQAWQSLPEFGLTYYLVRR

Amino Acids from 5' Exons

LAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLV,WPPGSWRRTRTWPRCPWSKPSCGSSRRGSHCLSLASPTTLS,GRPDPGGAPERGPDAPGRSQAAVHPGVAVTAVWPHLLPCQ

Amino Acids from 3' Exons

ENQYAQWMAACMLASKGKTMADSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKRHKSKQ,RINTPNGWLPACWHRRAKPWQTAPTSQRSSTSFHFGKTGTLHLRWLPVSKTWITQNVLCHHGVQKDTNPN,ESIRPMDGCLHVGIEGQNHGRQLLPARGPQHPFISEDEKQELCISGGFQSRKHGYEPRMFCVTTVCKKTQIQT