McDonnell Genome Institute

Washington University

CircRNA

chr20|57613162|57616468|-|ZBP1|ENST00000371173.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.998

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

EDGHLEQR

Amino Acids from 5' Exons

KILEEEQSQPQLFTSTIQSTSARMDPTAGFPLQTPKPSRLDTGTSLQDRQSPGRT,RFWKKSKVSLNYLPAQSNQHDLPEWTQQLDFHCKLRSHPDWTREHHYKTDSLQGG,DSGRRAKSASIIYQHNPINMICQNGPNSWISIANSEAIQIGHGNIITRQTVSRED

Amino Acids from 3' Exons

ATLNKESCRCQRLAPRNLPSWRNAKHPRGSSTKSSTEKRSKSPSHPLPPGAWAGLILKARVLQSWPCPAL,PPTKNPAGADRGWLPGETCPAGEGMPSTQEGAQPSPLPNEKGVESLPHIPCHLVLGRDSRRGSCRAGLVQP,HLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSP