McDonnell Genome Institute

Washington University

CircRNA

chr20|56386256|56386533|-|AURKA|ENST00000312783.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9233

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

LATAPVGGPK

Amino Acids from 5' Exons

ATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAP,LQLQLEVQNVFSLSNFLVRIHYLIVARLSGSCVLQILPSAFLCKHKSLSPVTSRFRIRSRSNCRQPVYLILSPGHITPKRASSPCHRHL,YSSSWRSKTCSRDSAISLSESITCKWPGSAGLVSFKFFPAHSFASTKACLQSQAGSESEAEAIAGNQCTSSCLQATEHPKEQAAPAIGT

Amino Acids from 3' Exons

ATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAP,LQLQLEVQNVFSLSNFLVRIHYLIVARLSGSCVLQILPSAFLCKHKSLSPVTSRFRIRSRSNCRQPVYLILSPGHITPKRASSPCHRHL,YSSSWRSKTCSRDSAISLSESITCKWPGSAGLVSFKFFPAHSFASTKACLQSQAGSESEAEAIAGNQCTSSCLQATEHPKEQAAPAIGT