McDonnell Genome Institute

Washington University

CircRNA

chr20|51712965|51729978|-|ATP9A|ENST00000311637.9

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

STAGSQHEVLR

Amino Acids from 5' Exons

GFVLAVTVIREAVEEIRCYVRDKEVNSQVYSRLTAR,ASCWPSLSSVRRWRRSDATCGTRKSTPRSTAGSQHE,LRAGRHCHPGGGGDPMLRAGQGSQLPGLQPAHST

Amino Acids from 3' Exons

VLRVAEMLRWRGGQAPHCLAGAPREERPEVSSECHQQSEVQFLHLSSW,CCEWLRCCGGGEARPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPG,AASGDAAVEGRPGPALSGWGTPRRETRGILGMSSTIRSTISSPFFL