McDonnell Genome Institute

Washington University

CircRNA

chr20|51435187|51524110|-|NFATC2|ENST00000371564.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9934

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

6

Peptide

RSQPQHFTYHPEEPNAHK

Amino Acids from 5' Exons

NMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHP,TCFLLRSLNIGTSISAHLKTSTSSMGRENEVSLSTLPTTQ,HAFCDPISEQAYPHTCKSELLRHQWEEKTKSASALYLPP

Amino Acids from 3' Exons

KSRMHIRSPAHPPDPHTPMMSWTMASSHTAPLLVSLASPPADSESRIGGRRSFARPSQQGPRAALGSRSLRPTNSRQWGPSAETRASWWSSRPWPGWPPARGSPCPCPASRATASRFAAPLAAAPLPASFLTPSPPTPRPASRPITAGPTTCVRSFKTSLLIIPPEPRQCHLEPASPRTAAWAATRPCPVRPPAPHRLVPSGGIRAPRPWLPCRPEPHPSAPGAPRRSPHLTWHPRTTAPRLGTPLWLALPSWMPTASPRTRLVGSPPRCGRPALTPRRCLPPHPRPACLATSTRPWSSWGPASRARGETRLQNPSCWFRPLGPSRWCLPFPSA,RAECTGRQPTLRTRIPRCPGLWPQAIQPPCSLWRAPRPIRRAGGRAAEVSERGQASRGLGPEPSDRDHSVPRTDPGSGAPPHERRGPPGGAAAPGRGGRQPEVHPARARLRGLPRAALLEPRQRLLCQLHFHLLPLHLALRLAQRRARRPVSAVSKHPCSLFPQNLANNVTSNQPRRGQLPGPPLARAPSGLPLLIAWCQAEAFVRRGLGCPAARSLTPALPEPLAAALISRGTPGPRLPGWVPPCGWLCRDHGCPEQPRHGLALWDPPQDVEDQPPLAGVCRPIQGRPASPHLPGRGVPGALRAGREEKLGSRIHPAGSAHLAQAAGACHSHLQ,EPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPIC