McDonnell Genome Institute

Washington University

CircRNA

chr20|50589685|50593196|-|FAM65C|ENST00000045083.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9756

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

AAGSWSR

Amino Acids from 5' Exons

ALLFYTNALAENDARLQQAACLALKHLK,LCCSTPTPWQRTTQGSSRPHARSNTS,FAVLHQRPGRERRKAPAGRMPSAQTPQ

Amino Acids from 3' Exons

RAAGSWSRWSAVVGCSPELGSQKNRSLPGSSFTATCRGRASLTWRSTSPSSPRK,VPQAPGAGGQLWWAAPRSWAPRRTDHYLVPVSQLPAEAERLPGEALHPAHQG,CRRLLEQVVSCGGLLPGAGLPEEQIITWFQFHSYLQRQSVSDLEKHFTQLTKE