McDonnell Genome Institute

Washington University

CircRNA

chr20|49260462|49263483|-|ZNFX1|ENST00000371744.5

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.904

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

IQIMTQMK

Amino Acids from 5' Exons

DSEWICFQHWKHSMMLEWLGLGVGSFTQSVSPAGPENT,IVNGFASSTGSIPCWSGVLVSVLSRKVFLQQDLRIQ,MDLLPALEAFHDAGVARSWCRFFHAKCFSSRTEY

Amino Acids from 3' Exons

IMTQMKESEQELHEGAKTLECTMRGVLREQYLQKYISPQHWESLMNGPVQ,SHRRSQSKSFMKEPRPWSAPCVVSYGNSTCRSTSHPSTGKVSMDQC,HDTDEGVRARASRSQDPGVHHAWCPTGTVPAEVHLTPALGKSHEWTSA