McDonnell Genome Institute

Washington University

CircRNA

chr20|49074784|49075520|+|CSE1L|ENST00000262982.2

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9742

83

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

AQTQKLLMK

Amino Acids from 5' Exons

LLMKKHLKIILRSTGEIWKDL,CRSIRFGVHKERFGRI,ADEEAFEDNSEEYIRRDLEGS

Amino Acids from 3' Exons

ILILDAGLLVIWYEDYASFLRDLQESSLVMLIPCCRNTQKIHLSTGNTKMQPSTHLWHQKPKHR,YYTQGCLSGTRIMQVFGTCDRNLLWLCFHAAGIRKKSICQLETQRCSHLPSDIFGIKSPNTE,IDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNPSVNWKHKDAAIYLVTSLASKAQTQK