McDonnell Genome Institute

Washington University

CircRNA

chr20|49058452|49072697|+|CSE1L|ENST00000262982.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9844

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

9

Peptide

VIVPNMEFRDPIAMELSDANLQTLTEYLK

Amino Acids from 5' Exons

ILQWNSAMQICKHQNIRKHLILILPSDVQ,SYSNGTQRCKSANTNRIFKENTSSCHPTS,PIAMELSDANLQTLTEYLKKTLDPDPAIRRP

Amino Acids from 3' Exons

LVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVPNMEFR,WVMQFNFWLQFVRDLIIRIYLRTRTRQVSVKRLLCLTWNLE,GKCNSISGFSLETSLESIGPEHADKYLKGYCAHGI