McDonnell Genome Institute

Washington University

CircRNA

chr20|48969146|48971354|+|ARFGEF2|ENST00000371917.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9077

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

MQIEESDAQGHQVAAR

Amino Acids from 5' Exons

ESDAQGHQVAARFSHVLQKDAFLVFRSLCKLSMKPLGEGPPDP,NRMHKDIKWLPGSPTFCRRMPSLCSAPCASCPNPLVKALQTQ,IGCTRTSSGCQVLPRSAEGCLPCVPLPVQAVHETPWRPSRPK

Amino Acids from 3' Exons

IPAAFQGGFPAAAPLCVAKCWPRIQDSRDVHQCNQAISLCGLVQKRRLFSACLALSCHFSYSSFKLNALENADR,SHELRSKVVSLQLLLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIE,PMSCVPRWFPCSCSSLCCKMLAPYSGLTRCSSMQSSNISVWPCPKTASLQCLMSLSSLLPFFLLFFQTLKCTKCR