McDonnell Genome Institute

Washington University

CircRNA

chr20|48688656|48708421|-|PREX1|ENST00000371941.3

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.982

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

GLPASTQTTPR

Amino Acids from 5' Exons

ASWAWSVMPTSLRRRGRSCTTTRRTSSRTAGESALSPSAFLA,PEAGHGACLRHDCGEGGEAVPHDDEQEGEPHQGPPEKAEHCPQVLSWQ,LKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLSTVPKCFLG

Amino Acids from 3' Exons

ELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWE,SWPRGLPASTQTTPRSRVPCRPRPFAPTSMRPSGRWRSWKPWSSCSPTSKAG,AGQEDSRQAPRPPRGPECPAGHEDRLLQHQDQAADGEAGSPGAAAVPHRRLG