McDonnell Genome Institute

Washington University

CircRNA

chr20|48676192|48708421|-|PREX1|ENST00000371941.3

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9363

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

LVDWLLAQELAKR

Amino Acids from 5' Exons

RPLPPEDLQVSASREQAGGLAAGS,DRDYHLKTYKSVLPGSKLVDWLLAQ,TVITTRPTSQCFPGASWWTGCWL

Amino Acids from 3' Exons

ELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWE,SWPRGLPASTQTTPRSRVPCRPRPFAPTSMRPSGRWRSWKPWSSCSPTSKAG,AGQEDSRQAPRPPRGPECPAGHEDRLLQHQDQAADGEAGSPGAAAVPHRRLG