McDonnell Genome Institute

Washington University

CircRNA

chr20|47246007|47356889|-|ZMYND8|ENST00000355972.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9751

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

QDGWLLLTR

Amino Acids from 5' Exons

AMKSRKMSIRPSTAIRRILRSQIVAIVSISVMMSRSLRTSQKTQRTKKVVRWTKSHLLLKKSPSLQTQWRLKRSKARHQPARRQTLEQSRTRPALSLRRTFPKRQNLHLTPRINREKMRRIPQQSIWAWTLIQRANLSIEKTILGGRVEKIRRNPKNHLPNRM,HKNLGRCLYGRRAQRFGGFEVRRVYQAEVERARRHRGQRRLSDGQRAICCKKAQAYKPSGDRGAEKHVTSQREGRPWSSQGQGQPAEGLFRKGKTFTSPHKGTEGKRDGFPNSPFGPGLFRERTCHRFRRRPFWAGGSKKEGTQRTISQTG,INEISEDVYTAVEHSDSEDSEKSDSSDSEYISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQD

Amino Acids from 3' Exons

DGSCSPEPHKDNRSGSVSANPGRLYTPICRGSQSGMSFYAARSSAEVPNPFSVRTRSLSSMFYKYHYTVLTMHPQ,MALAHPSLTKIIAQEVFQPIRGGFTLRFAGAANRGAFIRRPDHQPKCQTLFLELGACPPCFISIDITQCQCIHR,WLLLTRASQRSLRKCFSQSGAALHSDLPGQPIGDELLLGGQIISRSAKPFFCENEPVLHVLVLTLHSVNNASTE