McDonnell Genome Institute

Washington University

CircRNA

chr20|45843526|45844420|-|ACOT8|ENST00000217455.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

STELLLRR

Amino Acids from 5' Exons

ARATRCTAAWPPISPTMPSWALHCCLTSGSTRCTSWSHWTIPCGSTPPSELTTGCSMNARAPGP,RGRHEDALLRGRLYLRLCLLGHCTAASPVAAQGALHGLTGPFHVVPRPLPSPLDALMREPLG,EGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWA

Amino Acids from 3' Exons

GPPPKEVPIGAQPNCCSGGPHDQASKPIPPEPAAENGAQTDVLGASPGLY,DPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYI,TLTSKRGTHWRSTELLLRRSPLRSSQTHPPASCREWSPNRCSGCEPGAIL