McDonnell Genome Institute

Washington University

CircRNA

chr20|44995089|44997306|+|STK4|ENST00000372801.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9637

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

ATATQLLQDTMAKR

Amino Acids from 5' Exons

DTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMR,IPWPSGIQEHHFGWLQKFRKLDTTVQTSGPWELPKWLKESPLMLISIQ,YHGQAEYSDRNTILDGSRSDSGNWIQLCSRHLVPGNNCHRNGRKAPLCYPSNE

Amino Acids from 3' Exons

AIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQ,QSSFLQILLPHSENQSYGQITLQILNSVLRALSRGPQPLSSC,NLHDSYKSSSHIPKTRAMVRLYRFCETVSCKEPAEGHSHSAPA