McDonnell Genome Institute

Washington University

CircRNA

chr20|43623890|43642624|+|IFT52|ENST00000373030.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9306

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

LNQISDYMMLPYTATLSKR

Amino Acids from 5' Exons

ISDYMMLPYTATLSKRNRECLQESDEIPRDFTTLFDLSIFQLDTTSFHSVI,FLTTCCPTQPPYQSGIESVSRRVMRSQGTLPPSSTCPSSSWIPPPSTASS,FLHDAALHSHPIKAESRVSPGEDPKGLYHPLRPVHLPAGYHLLPQRHR

Amino Acids from 3' Exons

VLKKTWNFMSGSVVIFLEPVNYQRTNRMPNISLSTSSSKWWSSRNT,YRRPGILCQEVWYSWSNQTTKGPTGCQTYPARLLPSGGVQEIEP,TEEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHVFFQVVEFKKLNQ