McDonnell Genome Institute

Washington University

CircRNA

chr20|43603759|43619026|+|IFT52|ENST00000373030.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

IMFEILKK

Amino Acids from 5' Exons

FEILKKYLDTGGDVFVMLGEGGESRFDTNINFLLEEYGIMVNN,LKSRNILTLVEMSLCEKVENPDLTPILTFYKNMESWLIM,NPEEISHWWRCLCDARRRWRIQIHQYLFTRRIWNHG

Amino Acids from 3' Exons

NQGGKLAVLGSCHMFSDQYLDKEENSKIM,TKVGSWQCLVHVTCSVINIWTKKKTAKS,PRWEAGSAWFMSHVQSIFGQRRKQQNH