McDonnell Genome Institute

Washington University

CircRNA

chr20|43459770|43460241|+|SRSF6|ENST00000244020.4

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9018

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

MAEILGLLK

Amino Acids from 5' Exons

VVEVDTAVGEHLAETNTDHLFVQNTGLLKIFLVGAVGKI,WWRWIQQSENIWQRQIRTTCSYRIQAYCRKSFSVQLARFK,GGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLK

Amino Acids from 3' Exons

DFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRS,ILCDKQVKPMRMPTRNEQMRVLSFAPTLTSVLWTNWMAQKMAEILGLLKISHAQAIGDLTLEADP,FYATSRSNLCGCPQGTNKGCNVSLLLHEACFGQTGWHRNKWQKYAYRATHKPAILLWKQIQ