McDonnell Genome Institute

Washington University

CircRNA

chr20|41202056|41239704|-|ZHX3|ENST00000560361.5

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9908

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

RIGPTPSSR

Amino Acids from 5' Exons

IEGKPAFCKQLKKLHLETVSLALIEKLELVLLGPLWDKLSTADHPVIVTMASKRKSTTPCMIPVKTVVLQDASMEAQPAETLPEGPQQDLPPEASAASSEAAQNPSSTDGSTLANGHRSTLDGYLYSCKYCDFRSHDMTQFVGHMNSEHTDFNKDPTFVCSGCSFLAKTPEGLSLHNATCHSGEASFVWNVAKPDNHVVVEQSIPESTSTPDLAGEPSAEGADGQAEIIITKTPIMKIMKGKAEAKKIHTLKENVPSQPVGEALPKLSTGEMEVREGDHSFINGAVPVSQASASSAKNPHAANGPLIGTVPVLPAGIAQFLSLQQQPPVHAQHHVHQPLPTAKALPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQRLKQGISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQHLIQAALPGHVVGQPEGTGGGLLVTQPLMANGLQATSSPLPLTVTSVPKQPGVAPINTVCSNTTSAVKVVNAAQSLLTACPSITSQAFLDASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMIPGDHSSIIIDSVPEVSFSPSSKVPEVTCIPTTATLATHPSAKRQSWHQTPDFTPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKAEENASQEEEEAAEDEGGEEDLASELRVSGENGSLEMPSSHILAERKVSPIKINLKNLRVTEANGRNEIPGLGACDPEDDESNKLAEQLPGKVSCKKTAQQRHLLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQL,LNRENLLSANNKSCIKLFLWPSSRSWNLYCAPYGTSSQLLITQLSPWPARGNPPHHASQRLWCCKMPAWRPSPLRPCLKDPSRICPQKHLLPAVRQHRTPAVLMALHWPMGIGALMAIYIPVNTAISDPMTPNLWDITQSTQTLIKTQPLYAVGAVFWQKPLRGFPCTMPHVTPGKPALCGTWPSQTIMWLWSRASLRAPALLTRVSPVLKGLMDRQKSSLPKLQSRKAKLKPKKFIHSRRMSLASLWVRPYQSCRLEKWRERGTIPSSMGQFQSARHLPALQKTPMPPTGPEQCQFCQLAHSSSPSSSSPQCMPNTMSTSHCPRPRPFPKSPAAFQRTMQPWTLTASRTPSTSSPTPPKPSSAILWPSIQKNSSRSGSQPKGSRGSAGPLRRLRMPGKRCSIQSSSLCLSPQLRFIPHSSPVLAMSSISSRPLFQVTLWGSQRVQEGDFWSLSHWPMGCKQQVPLSPSRHPSPSSQVWHPLTLCVQIQRQLRWSMRPSRSSRPAPAPPKPSLMLASTKIRNLMNSCQLKGASVGTSSQGRAKLNISQKRASVPERCGNGSVIVDTTAGTRAPERYLEITVPSSLTLCQRCPSPHRPRSLRPAFRQQPHQPTLLPNDNLGTRLLTSHQPNTRREPLSSSEPWRAVLHKTLFLLMRNWTAEVKPKPDEKLIAGFQRDGKKMLRRPRRLRRMPLRRKRRLLRMRVEKRIWPVSGSLVKMALWKCPAAISWQSAKSAPLKSTRTGSLKPMAGTRFQGWVPVTLRMMSQTNWQSSSQAKAAKRLPSSGTCCGSSLSRHSGQATRTMTPSWPRRVCHGQRWCAGLEIAGTHRTANSNGTKTISEATSHQGYWSLPLATGSSCRTITHTRCCMKRTCRTSVTRPRAPSRSSSGLLRKWGRRPEPWQTQAVRTRALVLVSSQQFTKGWVTPIQRCLRTVSRGSPVSLRPAQSPLTHRVPRLDVSS,IGKTCFLQTTEKAAFRNCFFGPHREAGTCIVRPLMGQALNCSPSDCHHGQQEEIHHTMHDPSEDCGVARCQHGGPARDLARTPAGSAPRSICCQQGSTEPQQYWLYTGQWASEHFRWLFIFLILRFQIPHDPICGTYELRAHRLRPNLCMQWVQFSGKNPGAFLAQCHMSLRGSQLCVERGQARQSCGCGAEHPEHQHSPSGAQCRGWTGRNHHYQNSNHEDNERQSSQKNSYTQGECPPACGGLTKAVDWRNGGERGGPFLHQWGSSSQPGICQLCKKPPCRQRAPDRNSASFASWHSTVPLPPAAAPSACPTPCPPATAHGQGPSQSDDPPEQHSNVQCSHGLQLPEELLPQVPLPHQSRALLFDCGDQVSRRTAQDLVHSPKAEAGDQLVPGDGCPEKDVQYSHPVCASAHNYGSKYPTRRQCWQCPASHPGRSSRSRCGAARGYRRGTSGHSAIDGQWVASNKFPSPPHGDIRPQAARCGTHHCVFKYNVSCEGGQCGPVAPHGLPQHNLPSLPCHLQKEISTAVSSERELLSEPVPRAERSTSHKSDGPQYQRGAEMVQSIPLPELEGLQSDDTWRSQFHHHLCARGVLLPIVQGPGNLHSDNSHTSNPPFCQTTILAPDSLHTNQIQGESPAAQSPGEQFCTKPSSSGTGPPEKNQNDPTRNLVFRETEKSECGDQEGGECLSGGRGGCGGWRRGFGQAKGLWKWLSGNAQQPYLGRAQSQPHNQPEEPEGHSQWQERDSRAGCLPGVKQTGRAAPRQSELQKDCPAAALAAAALCPDTVAKQPGLLHHGPDGSATARGGALVWRQVRTEERPTQMVRRLARQLPTRATGHCPWQPGAPAGLLHDTQDAVRGPAEPLQDPDELPAGQAVVCENGGGDQSRGRHRQGPGPWYWAHSSSQRDGHLFRGVEQVVGAPCPGQLRALHIESPGWTSA

Amino Acids from 3' Exons

SLPETGNVCFCLLVGEGLVPPPAPGMDLDCLSPV,PFHRKQGMFVSVFWEKDWSHPQLQGWILIVAQS,PSIGNRECLFLSSGRRRIGPTPSSRDGSLFKPSQ