McDonnell Genome Institute

Washington University

CircRNA

chr20|41137520|41172877|+|PLCG1|ENST00000244007.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9785

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

AEDLPGQAGDAPDHVEPGR

Amino Acids from 5' Exons

EPPPGPARLPPQPQPQPQPPPLRLLPGGPGLCRRRPQRRSHGGRRVPLRQRLRARRALGRRGAAPLPQPRGGHRHDFVLLQEVAATRAEDLPGQAGDAPDHVEPGRRQDRGG,SRRRVPLVCRLSLSPNLSRRRCACSRAVLACAAAAPSVGAMAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGA,AAAGSRSSAASASAPTSAAAVALAPGRSWPVPPPPPASEPWRAPRPLAPTAAGPARPRTPRCCTSAAASRWAPSLCSTPRSRSDPSGRPSRSSWRRARSRGAGAPTRSRGP

Amino Acids from 3' Exons

TSLCRTRPSSRAGTVATCCSQAPCGMRPSTPLTRAASAGWSHVPSLL,QAYADEPGPLHDGQALWLRAAAKHHAGGLRPLQEQPPRAGAMCHLY,KPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAISIE