McDonnell Genome Institute

Washington University

CircRNA

chr20|41100055|41112925|+|TOP1|ENST00000361337.2

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9006

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

AVALYFIDKK

Amino Acids from 5' Exons

KIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCS,KSKRRMKNYKNMDSVLWITTKRGLLTSRSLLDFSVAAATTPRWACRDESCPRISSTVA,NQRGEKITERIWILYYGPQREDCLQDRASWTFPWPRQPPQDGHAEETNHARGYNHQLQ

Amino Acids from 3' Exons

GEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDK,VRRTGRNTRLLGGKNVWTRSGTSIEKTGSPKRKSGRELPCTSST,EGLAEIRDCSAAEKMCGQDPEPVSRRLEVQRDESPAESCSPVLHRQ