McDonnell Genome Institute

Washington University

CircRNA

chr20|37204766|37213865|+|RPN2|ENST00000237530.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9283

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

YIANTVEDLVAR

Amino Acids from 5' Exons

DLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKE,TLLLAWMNSGACISSLKKDWKQQRYLWLPPTSSWIMWGLSHPLR,PCCSPGTRGRVSPVRRTGNNSVICGCHLQAHGSCGDAIHG

Amino Acids from 3' Exons

GCFTKFHERQIFQWLLLPCRSRQPVYCKYRR,DVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVE,MFLNISTSNFPVVIMTSLSKLKVTTGILQIP